Duf5405 family protein

Author: qkjd

August undefined, 2024

WebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. Proteomes. Protein sets from fully sequenced genomes. Annotation systems. Systems used to automatically annotate proteins with high accuracy: UniRule (Expertly curated rules) WebOct 9, 2009 · The structure of Thermotoga maritima protein TM841, a protein from the family formerly called DUF194 (renamed DegV; PF02645), has been solved (Schulze …

Q06423 - UniProt

WebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. orf83 DUF5405 family protein [] Gene ID: 1260634, updated on 18-Nov-2024. Summary. Other designations. DUF5405 family protein ... WebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. AVT79_gp31 DUF5405 family protein [] Gene ID: 1262456, updated on 12-Oct-2024. Summary. Other designations. DUF5405 family protein ... can a money symnol be in a database

The domain of unknown function 4005 (DUF4005) in an

WebDUF5405 family protein 3800 M: M.Sbo268ORF2744P (99% identity) M.KmiBD50ORF3800P: 3805 replication endonuclease 6960 ATP-binding protein ... DUF977 family protein plasmid pBD-50-Km_3 : 32860 73 aa hypothetical protein 32865 M: M.Rte9185ORF7915P (100% identity) M.KmiBD50ORF32865P: 32870 76 aa … WebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. … WebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. F846_gp29 DUF5405 family protein [] Gene ID: 14181868, updated on 11-Oct-2024. Summary. Other … fisher scientific isotemp fridge ice

ORF83 - Uncharacterized 10.2 kDa protein in GpA 5

(IUCr) DUFs: families in search of function - Wiley Online …

WebThis mouse monoclonal antibody TJ1477 is generated from premade hybridoma library, and specific for Bacillus Phage Shbh1 DUF5405 domain-containing protein. This antibody … WebNational Library of Medicine 8600 Rockville Pike. Web Policies FOIA. Help Accessibility Careers fisher scientific isotemp hot plate manualWebView protein in InterPro IPR035404 DUF5405 Pfam View protein in Pfam PF17399 DUF5405 1 hit MobiDB Search… ProtoNet Search… Sequence Length 100 Mass (Da) 11,356 Last updated 1995-02-01 v1 Checksum 89CBA88D015642CA MFCSRAVVLLNNALKIAVMKNGDLSLIQLGLDKEKREITESVIAIYQSELNLLSDVVNLLVKRAVFHKQISSVDELTKLTTEIASYCADEFKKLNDKRNW … can a money tree be planted outside

"WebThis family of IGBTs was designed for optimum performance in the demanding world of motor control operation as well as other high voltage switching applications. These … " - Duf5405 family protein

Duf5405 family protein

DUF538 protein super family is predicted to be the potential ... - PubMed

WebA domain of unknown function (DUF) is a protein domain that has no characterised function. These families have been collected together in the Pfam database using the … WebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. Proteomes. Protein sets from fully sequenced genomes. Annotation systems. Systems used to automatically annotate proteins with high accuracy: UniRule (Expertly curated rules)

Did you know?

WebDUF5455 Entrez CDD Structure Protein Help pfam17537: DUF5455 Download alignment Family of unknown function (DUF5455) This is a family of unknown function found in … WebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. PLU_RS14615 DUF5405 family protein [] Gene ID: 24170245, updated on 16-Sep-2024. Summary. …

WebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. DDA3937_RS04160 DUF5405 family protein [] Gene ID: 9732280, updated on 8-Feb-2024. Summary. … WebHere we demonstrate that the domain of unknown function 4005 (DUF4005) of the Arabidopsis IQD family protein ABS6/AtIQD16 is a novel MT-binding domain. …

WebThe present study suggests that SVB and SVBL play a pivotal role in plant growth and trichome development by affecting a specific subset of known trichome developmental … WebSep 29, 2024 · Download alignment. 4F5 protein family. Members of this family are short proteins that are rich in aspartate, glutamate, lysine and arginine. Although the function …

WebDUF5405 family protein 3800 M: M.Sbo268ORF2744P (99% identity) M.KmiBD50ORF3800P: 3805 replication endonuclease 6960 ATP-binding protein 6965 …

WebTry our new Genome page and use the feedback button to let us know what you think fisher scientific isotemp hot plateWebDUF99 family protein 1455405 - Gene ResultSSO_RS01265 DUF99 family protein [] Gene provides a unified query environment for genes defined by sequence and/or in … fisher scientific isotemp hotplateWebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. PMI_RS09855 DUF5405 family protein [] Gene ID: 6800926, updated on 30-Dec-2024. Summary. Other designations. DUF5405 family protein ... fisher scientific isotemp incubator 637dWebLOCUS NC_022750 33628 bp DNA linear PHG 29-JUN-2024 DEFINITION Enterobacteria phage fiAA91-ss, complete genome. ACCESSION NC_022750 VERSION NC_022750.1 DBLINK BioProject: PRJNA485481 KEYWORDS RefSeq. can among us go above 60 fpsWebMar 10, 2024 · Title: The nuclear pore regulates GAL1 gene transcription by controlling the localization of the SUMO protease Ulp1. A prominent ~50-kDa sumoylated protein accumulates in a Ulp1 coiled-coil domain mutant; that was identified as Scs2, an endoplasmic reticulum (ER) membrane protein that regulates phosphatidylinositol … fisher scientific isotemp general freezerWebDUF538 protein super family includes a number of plant proteins that their role is not yet clear. These proteins have been frequently reported to be expressed in plants under various stressful stimuli such as bacteria and elicitors. In order to further understand about this protein family we utilize … fisher scientific isotemp manualWebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. … can a money tree live outside